Polypeptide Dmel\CG33205-PI

General Information
Symbol	Dmel\CG33205-PI	Species	D. melanogaster
Annotation Symbol	CG33205-PI	FlyBase ID	FBpp0099798
Associated gene	Dmel\CG33205	Created / Updated	2005-10-08/2005-10-08

Length (aa)	206	Theoretical pI	9.75
Predicted MW (kD)	23.0

Map ( GBrowse )
Sequence
	MVAQWKIINENYKNLEGYKRVAWPPASEERIIREFTPQPQTQSPAPGAGG YYPQAHAPTAAAAAPPQPQLPYSQDQTDLQQQQQQQQQQYPGAYAGQDSY RGASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEY KEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPG TQHIFG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG33205-RI FBtr0100386 2550
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG33205-RA FBtr0076335 2958 CG33205-RB FBtr0076333 3238 CG33205-RC FBtr0076331 3491 CG33205-RE FBtr0076336 2517 CG33205-RF FBtr0076334 2797 CG33205-RG FBtr0076332 3050 CG33205-RH FBtr0100385 2800
Other Polypeptides
	Name FlyBase ID Length (aa) CG33205-PA FBpp0076064 462 CG33205-PB FBpp0076062 501 CG33205-PC FBpp0076060 501 CG33205-PE FBpp0076065 315 CG33205-PF FBpp0076063 354 CG33205-PG FBpp0076061 354 CG33205-PH FBpp0099797 355
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001033998 DDBJ / EMBL / GenBank • ABC66158
Synonyms
	CG33205-PI
References ( 3 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]