Polypeptide Dmel\Act57B-PB

General Information
Symbol	Dmel\Act57B-PB	Species	D. melanogaster
Annotation Symbol	CG10067-PB	FlyBase ID	FBpp0099533
Associated gene	Dmel\Act57B	Created / Updated	2005-10-08/2005-10-08

Length (aa)	36	Theoretical pI	6.54
Predicted MW (kD)	4.0

Map ( GBrowse )
Sequence
	MCDDEVAALVVDNGAYSPSNGLSSWLLLKEKKKKEK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Act57B-RB FBtr0100177 2384
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Act57B-RA FBtr0071519 1726
Other Polypeptides
	Name FlyBase ID Length (aa) Act57B-PA FBpp0071448 376
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_726007 DDBJ / EMBL / GenBank • AAM68186
Synonyms
	Act57B-PB
References ( 3 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]